( PDF ) Amplificação, clonagem, superexpressão e purificação da enzima citidina deaminase (Cdd, E.C. 3.5.4.5) de Mycobacterium tuberculosis

Download PDF

ads:

Pontifícia Universidade Católica do Rio Grande do Sul

Faculdade de Biociências

Programa de Pós-Graduação em Biologia Celular e Molecular

Amplificação, clonagem, superexpressão e purificação da enzima citidina

deaminase (Cdd, E.C. 3.5.4.5) de Mycobacterium tuberculosis

Autor

Zilpa Adriana Sánchez Quitian

Orientador

Prof. Dr. Diógenes Santiago Santos

Co-orientador

Prof. Dr. Luiz Augusto Basso

Porto Alegre

Fevereiro 2009

ads:

Livros Grátis

http://www.livrosgratis.com.br

Milhares de livros grátis para download.

Pontifícia Universidade Católica do Rio Grande do Sul

Faculdade de Biociências

Programa de Pós-Graduação em Biologia Celular e Molecular

Amplificação, clonagem, superexpressão e purificação da enzima citidina

deaminase (Cdd, E.C. 3.5.4.5) de Mycobacterium tuberculosis

Dissertação apresentada ao

Programa de Pós-Graduação

em Biologia Celular e Molecular

como requisito para obtenção do

grau de Mestre.

Autor

Zilpa Adriana Sánchez Quitian

Orientador

Prof. Dr. Diógenes Santiago Santos

Co-orientador

Prof. Dr. Luiz Augusto Basso

Porto Alegre

Fevereiro 2009

ads:

AGRADECIMENTOS

Ao Prof. Diógenes Santiago Santos pela oportunidade de ingressar no

CPBMF e, especialmente, pela confiança em mim depositada e ajuda durante

todo o mestrado.

Ao Prof. Luiz Augusto Basso pelos ensinamentos, correções e revisões,

que possibilitaram a conclusão deste trabalho.

Ao Cristopher Schneider, Rodrigo Ducati e Cláudia Nunes, pela

colaboração nas correções, revisões, sugestões e pelo constante apoio e

motivação.

Agradeço aos meus amigos de laboratorio, pela ajuda na realização

deste trabalho e por sempre me darem amor e força; eles estiveram sempre

presentes, me aconselhando e incentivando com carinho e dedicação.

Também sou grata pelas trocas que fizemos a respeito de música, samba,

festas e alegria no Brasil e, principalmente, por sempre demonstrar interesse

no meu bem-estar.

Ao Programa de Pós-Graduação em Biologia Celular e Molecular da

PUCRS.

Ao CNpq pela bolsa fornecida durante o mestrado.

À família Horna Vargas que, desde o primeiro momento, me deu todo o

apoio, colaboração e carinho, me acompanhando cada dia, durante estes anos.

Aos amigos que conheci em POA, pelos momentos divertidos que

passamos juntos, pela energia positiva e pelo carinho e amizade que me

ofereceram.

Agradeço profundamente a minha família, que apesar de não estar

fisicamente presente, sempre buscou o meu bem-estar desde o meu país, a

Colômbia, e é evidente que, sem o esforço feito por eles, a minha pós-

graduação não teria sido possível, especialmente à minha mãe, por suportar

pacientemente uma filha distante da vida familiar. Para meus pais, Ruby e

Cristobal, a minha irmã Moni, meus primos, Juanita, Mauro, Kathe e Marce, e

meus tios, Zilpa, Manlio e Omar, que, apesar da distância, a moral, o apoio e a

alegria me deram a força para continuar.

ÍNDICE

Agradecimentos i

Lista de Abreviaturas v

Resumo viii

Abstract viii

1 INTRODUÇÃO.........................................................................................................1

1.1 Tuberculose .......................................................................................................1

1.2 Tuberculose e latência.......................................................................................3

1.3 Metabolismo de nucleotídeos ............................................................................4

1.3.1 Síntese de novo das pirimidinas .....................................................................5

1.3.2 Rota de salvamento das pirimidinas................................................................6

1.4 Citidina deaminase ............................................................................................8

2 OBJETIVOS...........................................................................................................12

2.1 OBJETIVO GERAL..........................................................................................12

2.2 OBJETIVOS ESPECÍFICOS............................................................................12

3. ARTIGO CIENTÍFICO ...........................................................................................13

Abstract..................................................................................................................16

Introduction............................................................................................................17

Materials and Methods...........................................................................................20

Results and Discussion..........................................................................................25

Acknowledgments..................................................................................................31

References ............................................................................................................32

Figures and legends ..............................................................................................37

4.CONSIDERAÇÕES FINAIS...................................................................................43

ANEXO 1. DESENVOLVIMENTO DA TUBERCULOSE ..........................................45

ANEXO 2. TESTES DE PURIFICAÇÃO DA CDA DE M. TUBERCULOSIS ............46

ANEXO 3. CRISTALIZAÇÃO DA CDA DE M. TUBERCULOSIS.............................47

ANEXO 4. CONFIRMAÇÃO DO ARTIGO SUBMETIDO..........................................48

REFERÊNCIAS BIBLIOGRÁFICAS.........................................................................49

LISTA DE ABREVIATURAS

AIDS: síndrome de imunodeficiência adquirida

ATP: Adenosina trifosfato

BCG: Bacillus Calmette-Guérin

CDA: citidina deaminase

codA: citosina deaminase

CMP: citidina monofosfato

CP: carbamoilfosfato

CPSae: carbamoilfosfato sintetase

CTP: citidina trifosfato

D-CDA: citidina deaminase homodimérica

dCTP: desoxicitidina trifosfato

deoA: timina fosforilase

DHOase: dihidroorotato desidroorotase

DHOhase: dihidroorotato desidrogenase DNA:Ácido desoxirribonucléico

dNTP: desoxirribonucleosídeo trifosfato

DOTS: tratamento supervisionado de curta duração (directly observed

treatment short-course)

dTTP: desoxitimidina trifosfato

hCDA: citidina deaminase humana

HIV: vírus de imunodeficiência humana

HPLC: cromatografia líquida de alta eficiência

IPTG: isopropil β-D-tiogalactopiranosídeo

LB: Luria–Bertani

MDR-TB: TB resistente a múltiplas drogas

NDP: nucleosídeo difosfato

NMP: nucleosídeo monofosfato

NTP: nucleosídeo trifosfato

OMP: orotidina 5’-monofosfato

PRPP: D-5-fosforibosil-1-fosfato

RNA: ácido ribonucléico

rNTP: ribonucleosídeo trifosfato

TB: tuberculose

T-CDA citidina deaminase homotetramérica

udk: uridina quinase

udp: uridina fosforilase

UDP: uridina difosfato

UMP: uridina monofosfato

UPRTase: uracil fosforibosiltransferase

UTP: uridina trifosfato

WHO: Organização mundial da Saúde (Wold Health Organization)

XDR-TB: TB extremamente resistente a drogas (extensively drug-resistant TB)

RESUMO

A tuberculose (TB) é considerada uma ameaça à saúde pública mundial;

segundo a Organização Mundial da Saúde, cerca de dois milhões de pessoas

morrem anualmente em conseqüência desta doença. Uma das características

mais importantes do patógeno causador da TB é a sua capacidade de persistir

nos tecidos do hospedeiro por um longo período em um estado de latência,

também conhecido como persistência. A importância do estado de latência à

sobrevivência do bacilo tem sido um atrativo fator para o desenvolvimento de

trabalhos que caracterizem com maior profundidade esta fase da infecção por

M. tuberculosis. O entendimento do modo de ação e o papel das enzimas da

rota de salvamento de pirimidinas em M. tuberculosis poderia revelar novos

alvos para o desenho racional de agentes anti-TB potentes e seletivos capazes

de, se possível, prevenir a progressão e a reativação da doença. A citidina

deaminase (CDA, EC 3.5.4.5), uma enzima evolutivamente conservada da rota

de salvamento das pirimidinas, catalisa a deaminacao hidrolítica de citidina e

2’-desoxicitidina para formar uridina e 2’-desoxiuridina, respectivamente. O

provável gene da CDA (cdd, Rv3315c) de M. tuberculosis foi clonado,

seqüenciado e expresso em células de Escherichia coli BL21(DE3). O

protocolo de purificação da CDA recombinante de M. tuberculosis (MtCDA)

produziu 35 mg de proteína homogênea a partir de 10 g de células. A análise

de espectrometria de massas, seqüenciamento N-terminal e cromatografia por

gel filtração confirmaram a massa molecular prevista, a identidade e o estado

oligomérico de MtCDA, que foi estimada em 52,99 kDA. Estes resultados e os

de alinhamento múltiplo de seqüências sugere que MtCDA é um

homotetrâmero em solução. Medidas de cinética em estado estacionário da

CDA geraram os seguintes parâmetros: valores de K

e k

cat

de,

respectivamente, 1004 µM e 4,8 s

-1

para citidina, e 1059 µM e 3,5 s

-1

para 2'-

desoxicitidina. A dependência dos valores de k

cat

e k

cat

em função do pH

para citidina indicam que a protonação de um único grupo ionizável com valor

de pKa de 4,3 elimina a atividade, e a protonação de um grupo com pKa de 4,7

reduz a ligação ao substrato. Foram obtidos cristais de CDA utilizando o

método de difusão de vapor em gota pendente. A demonstração de que o locus

Rv3315c codifica uma proteína com atividade CDA em M. tuberculosis é o

primeiro passo para entender o papel do produto deste gene e deverá ajudar

no desenho de agentes anti-TB e vacinas.

Palavras-chave: Mycobacterium tuberculosis; rota de salvamento de

pirimidinas; Citidina deaminase; purificação protéica; cinética enzimática; alvo

protéico.

ABSTRACT

The Tuberculosis (TB) is considered a threat to global public health;

according to the World Health Organization, nearly two million people die

annually due to this disease. One of the most importat features of this pathogen

is its ability to persist in host tissues for a long period in a state of latency, also

known as persistence. The importance of the state of latency to the bacillus

survival has been an attractive factor towards the development of works to

characterize in greater detail this phase of infection by M. tuberculosis. An

understanding of the mode of action and the role of pyrimidine salvage pathway

enzymes in M. tuberculosis could reveal new targets for the rational design of

potent and selective anti-TB agents capable of, hopefully, preventing

progression and reactivation of the disease. Cytidine deaminase (CDA; EC

3.5.4.5), an evolutionarily conserved enzyme of the pyrimidine salvage

pathway, catalyzes the hydrolytic deamination of cytidine and 2’-deoxycytidine

to form uridine and 2’-deoxyuridine, respectively. The probable CDA gene (cdd,

Rv3315c) from M. tuberculosis H37Rv was cloned, sequenced, and expressed

in Escherichia coli BL21(DE3) cells. The purification protocol of recombinant M.

tuberculosis CDA (MtCDA) yielded 35 mg of homogeneous protein from 10 g of

cells. Mass spectrometry, N-terminal amino acid sequencing, and gel filtration

chromatography confirmed the predicted molecular mass, identity, and

oligomeric state of MtCDA, which was estimated to be 52.99 kDa. These results

and the ones for multiple sequence alignment suggest that MtCDA is a

homotetramer in solution. Steady-state kinetic measurements yielded the

following parameters: K

and k

cat

values of, respectively, 1004 µM and 4.8 s

-1

for cytidine, and 1059 µM and 3.5 s

-1

for 2'-deoxycytidine. The pH dependence

of k

cat

and k

cat

for cytidine indicates that the protonation of a single ionizable

group with pKa value of 4.3 abolishes activity, and protonation of a group with

pKa value of 4.7 reduces substrate binding. Crystals of CDA were obtained

using the hanging-drop vapour-diffusion method. The demonstration that the

Rv3315c locus encodes a protein having CDA activity in M. tuberculosis is the

first step to understand the role of this gene product and should help the design

of anti-TB agents and vaccines.

Keywords: Mycobacterium tuberculosis; pyrimidine salvage pathway; cytidine

deaminase; protein purification; enzyme kinetics; drug target.

1 INTRODUÇÃO

1.1 Tuberculose

A tuberculose (TB), doença infecciosa causada pelo bacilo Mycobacterium

tuberculosis, é considerada uma ameaça à saúde pública mundial, visto que,

segundo dados da Organização Mundial da Saúde, cerca de dois milhões de

pessoas morrem anualmente em conseqüência desta enfermidade [25, 26].

Estudos indicam que a incidência global da TB é de 137 casos por 100.000

habitantes, sendo menor nas Américas (onde se apresentam 46 casos de TB

por 100.000 habitantes) e maior na África (com 290 casos de TB por 100.000

habitantes). Este último dado está correlacionado com a alta prevalência da

infecção por HIV que afeta esta região, além da extrema pobreza e falta de

medicamentos [7].

Segundo o relatório da Organização Mundial da Saúde, na América do Sul,

países como Bolívia, Peru e Equador apresentam o maior índice de casos de

TB, com uma incidência de 211, 172 e 131 casos por 100.000 habitantes,

respectivamente (ver Tabela 1). Já no Brasil estima-se que, anualmente,

ocorrem 161.800 novos casos positivos de TB, com uma incidência de 60

casos (incluindo todas as formas de TB), por 100.000 habitantes. Além disso,

apresenta-se uma taxa de 0.9% de novos casos de TB resistente a múltiplas

drogas [26].

Dados epidemiológicos mostram a evolução crescente dos casos de TB em

todo o mundo, e, caso o controle da doença não seja reforçado, estima-se que,

de hoje até 2020, mais de um bilhão de pessoas serão infectadas, cerca de

200 milhões desenvolverão TB ativa, e 70 milhões morrerão [19]. Um exemplo

dos esforços para combater a TB é o plano de eliminação da tuberculose em

nível mundial para o ano 2015, realizando diferentes investimentos para

pesquisas e programas de controle que permitam atingir esta meta. Este plano

está sendo implementado pela Organização Mundial da Saúde (World Health

Organization) [26].

Tabela 1. Incidência, prevalência e mortalidade da tuberculose na América do

Sul

Indicadores

Paises

Incidência

(todos os

casos/100.0000 hb/ano)

Prevalência

(todos os

casos/100.0000 hb/ano)

Mortalidade

(todos os

casos/100.0000 hb/ano)

Argentina 41 51 5.5

Bolívia 211 280 31

Brasil 60 76 8.1

Chile 15 16 1

Colômbia 45 66 7.0

Equador 131 202 27

Paraguai 68 100 12

Peru 172 206 20

Uruguai 28 33 3

Venezuela 42 52 5

Retirado de WHO report 2007 Global tuberculose control

Em todo o mundo, cerca de 3.2% dos novos casos de TB são causados por

cepas resistentes a múltiplas drogas. Nestes casos, o tratamento requer a

administração de medicamentos de segunda linha, que geram efeitos adversos

maiores e aumento dos custos (cerca de 100 vezes) em comparação com as

drogas de primeira geração [17]. O surgimento de cepas resistentes e

multirresistentes constituem outro sério problema para o controle e erradicação

da TB; diversos relatórios mostram o surgimento de cepas multirresistentes em

pacientes infectados com HIV nos quais se observou um índice de mortalidade

superior a 80% [11].

A cada ano, cerca de 400.000 novos casos de TB resistente a múltiplas drogas

(MDR-TB) são relatados. Assim, como medida de controle, a Organização

Mundial da Saúde implementou um procedimento padronizado para garantir o

uso correto das drogas que compõem o tratamento da TB, o qual é conhecido

como DOTS (tratamento supervisionado de curta duração, do inglês directly

observed treatment short-course), no qual agentes de saúde acompanham todo

o tratamento do paciente com TB, monitorando periodicamente o uso correto

dos medicamentos, a fim de impedir o abandono da quimioterapia e o possível

surgimento de cepas multirresistentes [11, 26]. Outro tipo de cepa

multirresistente de M. tuberculosis foi relatado pela Organização Mundial da

Saúde em setembro de 2006, denominada XDR-TB (extensively drug-resistant-

TB), a qual é definida como casos de TB resistentes a 2 drogas de primeira

linha (isoniazida e rifampicina) e no mínimo 3 das 6 principais classes de

drogas de segunda linha [27]. Tanto as cepas MDR quanto as XDR levam ao

uso de drogas de segunda linha, o que aumenta os efeitos colaterais, o custo e

o tempo do tratamento, além de requerer maior tecnologia para o diagnóstico

preciso das cepas de M. tuberculosis, a qual não está disponível em muitos

países afetados pela doença. Estes fatos evidenciam que tanto o surgimento

como o aumento do número de cepas de M. tuberculosis resistentes às drogas

antimicobacterianas convencionais representam um risco para o controle da

TB. Conseqüentemente, a vigilância do tratamento e pesquisas avançadas

para o desenvolvimento de novas drogas tornaram-se uma prioridade na luta

contra a TB.

1.2 Tuberculose e latência

Uma das características mais importantes do patógeno causador da TB é a sua

capacidade de persistir no hospedeiro humano por longos períodos em estado

de latência, quando não se apresentam manifestações clínicas que permitem

sua identificação. Nesta fase da infecção, também conhecida como

persistência, o bacilo da TB diminui drasticamente seu metabolismo e

praticamente não se multiplica, como conseqüência da resposta imune celular

que o hospedeiro monta para tentar erradicar a infecção [8].

Pesquisas feitas utilizando a prova intradérmica de tuberculina estimam que um

terço da população mundial esteja infectada com M. tuberculosis, o que

representa um reservatório importante para o surgimento de novos casos [7].

Estes reservatórios dos quais pode surgir a doença ativa são incrementados

pela pandemia de AIDS em doentes infectados com o HIV, o que gera um

obstáculo a mais para o controle da TB. Dados revelam que o risco de

progressão da infecção do estado latente para o ativo é de 8-10% por ano [7].

A formação de granulomas, característicos deste estado da doença, faz com

que o patógeno seja isolado e sua replicação controlada, mas sem chegar a

erradicá-lo. Esta forma isolada do bacilo pode viver por décadas em um estado

de dormência, em que ocorre uma mínima replicação e expressão diferencial

de genes que lhe permitem sobreviver. A ativação da TB ocorre quando o

sistema imune do hospedeiro decai, resultando em uma massiva replicação do

bacilo e reativação da TB (ver anexo 1), sendo neste ponto transmissível a

outras pessoas [1].

A atual vacina contra a TB, Mycobacterium bovis Bacillus Calmette-Guérin

(BCG), foi introduzida há mais de 60 anos e é utilizada amplamente no mundo.

Esta vacina protege contra a manifestação severa em crianças, mas não

impede a reativação pulmonar em adultos ou o estabelecimento da forma

latente do bacilo [1]. Um dos alvos importantes para o desenvolvimento de

vacinas contra a TB é o estado de latência e os genes que são

diferencialmente expressos quando o bacilo passa do estado ativo ao de

latência, em resposta ao sistema imune do hospedeiro. Desta maneira, genes

que são fundamentais para a sobrevivência do bacilo na fase de latência se

mostram agora em pontos de interesse para estudo no desenvolvimento de

vacinas [12].

1.3 Metabolismo de nucleotídeos

Os nucleotídeos são compostos que fazem parte de um grande número de

processos bioquímicos nas diferentes formas de vida. A importância dos

nucleotídeos no metabolismo celular é suportada pelo fato de que quase todas

as células podem sintetizá-los tanto de novo como a partir dos produtos de

degradação dos ácidos nucléicos, o que se denomina salvamento ou

recuperação [2,24].

Mais do 95% dos nucleotídeos são encontrados na fração ácido-insolúvel das

células como nos ácidos nucléicos. A fração solúvel do ácido consiste de

nucleosídeos mono, di, e trifosfatos (NMPs, NDPs e NTPs) e nucleotídeos

como componentes de coenzimas. Nucleosídeos trifosfato são precursores de

ácidos nucléicos e coenzimas. Os nucleotídeos que atuam como componente

de coenzimas, assim como pequenas frações de ácidos nucléicos, sofrem uma

alta conversão, produzindo NMPs e NDPs como produto. Para uma síntese

estável de RNA e DNA requer-se constante administração de ribonucleosídeos

trifosfato (rNTP) e deoxiribonucleosídeos trifosfato (dNTPs), que na ausência

destes, devem ser fornecidos através da biosíntese de novo [15]

1.3.1 Síntese de novo das pirimidinas

A síntese de novo das pirimidinas é iniciada com a síntese de carbamoilfosfato

desde glutamina, bicarbonato e ATP, reação catalisada pela carbamoilfosfato

sintetase (CPSase). A condensação do carbamoilfosfato com aspartato pela

aspartato transcarbamilase produz N-carbamilaspartato formando-se o anel da

pirimidina, através de ciclização e oxidação, o qual é transformado a

dihidroorotato pela dihidroorotato dihidroorotase (DHOase). Posteriormente,

ocorre a oxidação do dihidroorotato a orotato pela dihidroorotato

deshidrogenase (DHOhase). O orotato é convertido ao nucleotídeo

correspondente pela –D-5-fosforibosil-1-fosfato (PRPP), formando orotidina 5`-

monofosfato (OMP), a qual é subsequentemente descarboxilado a uridina

monofosfato (UMP). A conversão de UMP ao trifosfato ocorre pela fosforilação

de UMP a uridina difosfato (UDP) e depois à uridina trifosfato (UTP) pela ação

da UMP quinase e NDP quinase (nucleosídeo de fosfato quinase). Finalmente,

UTP é aminado a citidina trifosfato (CTP) pela CTP sintetase (fig. 1) [15, 16].

Figura 1. Síntese de novo das Pirimidinas. Abreviações: carbamoilfosfato (CP),

uridina monofosfato (UMP), uridina trifosfato (UTP), citidina trifosfato(CTP),

desoxicitidina trifosfato (dCTP), desoxiuridina trifosfato (dUTP) e desoxitimidina

trifosfato (dTTP).

dTTP dUTP dCTP CTP UTP UMP CP

DNA

RNA

Arginina

ATP

HCO

Glutamina

1.3.2 Rota de salvamento das pirimidinas

A rota de salvamento de pirimidinas apresenta três funções fisiológicas. A

primeira é a assimilação de bases exógenas livres e nucleosídeos; os

nucleosídeos são predominantemente metabolizados a bases livres antes de

serem usados para síntese de nucleotídeos. A segunda função é a fabricação

da pentose dos nucleosídeos exógenos utilizando esta como origem de

carbono e energia; e o grupo amino dos compostos com citosina como origem

de nitrogênio. A terceira função é a reutilização de bases livres e nucleosídeos

produzidos intracelularmente desde a reciclagem dos nucleotídeos.

Para a utilização de bases pirimidínicas, como o uracil, é necessário a uracil

fosforibosiltransferase (UPRTase), a qual converte o uracil a UMP. No entanto,

o metabolismo da citosina ocorre através da deaminação pela citosina

deaminase (codA) a uracil e amônia.

A uridina, é convertida a UMP mediante fosforilação pela uridina quinase (udk)

ou pela clivagem a uracil e ribose 1-fosfato através da uridina fosforilase (udp)

e posterior conversão do uracil ao UMP pela UPRTase.

A rota para utilização de citidina e desoxicitidina ocorre através da deaminação,

a uridina e desoxiuridina, respectivamente, catalisada pela citidina deaminase

(CDA). O produto, uridina, é diretamente convertido a CMP pela uridina

quinase.

A desoxiuridina e a timina podem ser utilizadas por duas rotas diferentes. Na

primeira, a timina quinase, a qual é codificada pelo gene tdk, fosforila estes

componentes até monofosfatos. Na segunda rota, a timina fosforilase (deoA)

cliva estes nucleosídeos a deoxiribose 1-fosfato e a base livre correspondente

(fig.2) [15, 16, 20, 24].

Figura 2. Rota de salvamento de pirimidinas. As enzimas envolvidas nesta rota

são identificadas pelo símbolo de seu gene: cdd, citidina (desoxicitidina)

deaminase; codA, citosina deaminase; deoA, timina (desoxiuridina) fosforilase;

deoB, fosfopentomutase; deoC, deoxiriboaldose; tdk, timidina (desoxiuridina)

quinase; thyA, TSase; udk,uridina (citidina) quinase; udp, uridina fosforilase;

upp, UPRTase; 1, CMP glicosilase [15].

Diferentes estudos demonstram que organismos tão divergentes como

Escherichia coli, leveduras e humanos possuem rotas similares para a

biosíntese de nucleotídeos pirimidínicos, o que não é diferente em

micobactérias, onde se tem estabelecido, apesar de pouca informação a

respeito, que o metabolismo de pirimidinas é similar ao de humanos e outros

organismos. Estudos mostram que mutantes de enzimas desta rota metabólica

poderiam afetar o crescimento e vários estados fisiológicos deste patógeno na

fase de latência do bacilo [9, 23].

Pouco se conhece sobre a função e preferência de substratos destas enzimas,

sendo necessário ampliar o conhecimento com a realização de estudos que

melhor caraterizam estas enzimas.

1.4 Citidina deaminase

Citidina deaminase (CDA) (E.C.3.5.4.5) é uma enzima que catalisa a

deaminação hidrolítica irreversível de citidina e desoxicitidina a uridina e

desoxiuridina, respectivamente [6,28].

Citidina + H

citidina deaminase

Uridina + NH

Estudos bioquímicos e estruturais da CDA em bactérias sugerem o mecanismo

de reação apresentado na figura 3. Esta enzima tem sido caracterizada em E.

coli, Bacillus subtilis e humanos [3, 5, 10], e contém um átomo de zinco no sítio

ativo que polariza uma molécula de água que ataca nucleofilicamente o C4 do

anel da citidina pela protonação do adjacente na posição N3. O intermediário

tetraédrico resultante decompõe-se pela eliminação de amônia, o que produz

uridina [5].

X= OH: citidina intermediário tetraédrico x= OH: uridina

X= H:2’

desoxicitidina

x= H: 2’

desoxicitidina

Tomado de Chung S.J et. al. J.Med. Chem.2005,48,658-660.

Figura 3. Mecanismo de reação proposto para CDA

O átomo de zinco que a enzima contém é essencial para a catálise. Dois tipos

de CDA têm sido identificadas na natureza: uma homodimérica (D-CDA), com

uma subunidade que apresenta uma massa molecular de 32kDa, e uma

homotetramérica (T-CDA), com uma massa molecular aproximada de 15 kDa.

D-CDAs são encontradas em bactérias Gram-negativas, tais como Escherichia

coli e plantas, enquanto que T-CDAs são encontradas em bactérias Gram-

positivas como Bacillus subtilis e muitos outros organismos eucariotos,

incluindo mamíferos [10].

A estrutura obtida a partir dos cristais de organismos como B. subtilis [10] e E.

coli [3] tem sido determinada. Ambas as classes de CDAs contêm uma forte

ligação por subunidade, catalisada pelo íon de zinco. A subunidade da enzima

de E. coli tem dois domínios com as mesmas características que a subunidade

T-CDA, resultando em centros estruturais similares da D-CDA e T-CDA (Figura

1).

Figura 4: Estrutura de (a) T-CDA de B. subtilis e (b) D-CDA de E. coli. As

subunidades de T-CDA são mostradas em magenta, verde e azul

respectivamente. As subunidades de D-CDA são mostradas em vermelho e

amarelo com as ligações respectivas entre o sítio catalítico e o domínio C-

terminal em azul e ciano. Os íons de zinco e inibidores são mostrados em

modelo de palitos [13]

Porém, apenas um dos domínios da D-CDA em cada subunidade é ligado ao

zinco, sendo só dois sítios ativos por molécula de enzima em contraste com

quatro na T-CDA. Os sítios ativos da T-CDA são compostos por resíduos de

três das quatro subunidades para o tetrâmero.

Estudos de alinhamento entre diferentes organismos revelam a presença de

resíduos de tirosina nas T-CDA que não foram encontrados em nenhuma

seqüência de D-CDA. CDA de M. tuberculosis apresenta estes resíduos, o que

sugere uma estrutura tetramérica para esta enzima [4].

A CDA de humanos (hCDA) tem se mostrado interessante pelo importante

papel que tem no metabolismo de nucleosídeos antitumorais e antivirais

análogos de citidina, levando à inativação farmacológica, e efeitos secundários

indesejáveis. Um exemplo é a perda da atividade antineoplásica da citosina-

arabinosídeo, um agente quimioterapêutico utilizado no tratamento contra o

câncer [21].

Outro importante papel da CDA é a sua participação na deaminação de bases

no RNA e DNA de simples e dupla fitas. A modificação destas bases gera no

RNA um códon de parada, enquanto que, no DNA promove a diversidade de

anticorpos [14].

A caracterização da CDA de M. tuberculosis poderia ser útil para aumentar

nosso conhecimento desta enzima e também como tentativa para identificar

potenciais alvos para o desenvolvimento de drogas e vacinas.

2 OBJETIVOS

2.1 OBJETIVO GERAL

Este estudo faz parte de um projeto desenvolvido no Centro de Pesquisa em

Biologia Molecular e Funcional (CPBMF) com a finalidade de estudar enzimas

utilizadas pelo bacilo M. tuberculosis durante a infecção. O objetivo geral na

realização deste trabalho foi a caracterização da enzima citidina deaminase

envolvida na via de salvamento de pirimidinas de M. tuberculosis.

2.2 OBJETIVOS ESPECÍFICOS

1. Desenho de primers e amplificação do gene cdd que codifica a proteína

citidina deaminase;

2. Clonagem do gene amplificado no plasmídeo pCR-Blunt e posterior

subclonagem no vetor de expressão pET-23a(+);

3. Realizar testes de expressão da proteína recombinante em diferentes

linhagens de E. coli e condições de crescimento (temperatura, meio de

cultura, adição de IPTG, etc), a fim de estabelecer um protocolo que

permita a expressão da proteína em forma solúvel;

4. Estabelecer um protocolo de purificação que permita obter a proteína

citidina deaminase altamente pura, utilizando o método de cromatografia

líquida de alta eficiência (HPLC);

5. Determinar parâmetros cinéticos da proteína usando como substrato a

adenosina;

6. Realizar a análise de espectrometria de massas e seqüenciamento total

da proteína purificada.

3. ARTIGO CIENTÍFICO

Title of the article

The Rv3315c locus from Mycobacterium tuberculosis H37Rv codes for a

functional cytidine deaminase that hydrolyses cytidine and 2’-deoxycytidine

Periodic chosen for submission

Protein expression and purification

The Rv3315c locus from Mycobacterium tuberculosis H37Rv codes for a

functional cytidine deaminase that hydrolyses cytidine and 2’-

deoxycytidine

Zilpa A. Sánchez Quitian

a,b

, Cristopher Z. Schneider

, Rodrigo G. Ducati

a,c

, Carlos

Bloch Junior

, Diógenes S. Santos

*, and Luiz A. Basso

Centro de Pesquisas em Biologia Molecular e Funcional (CPBMF), Instituto Nacional

de Ciência e Tecnologia em Tuberculose (INCT-TB), Pontifícia Universidade Católica

do Rio Grande do Sul (PUCRS), Av. Ipiranga, 6681, Porto Alegre, RS 90619-900,

Brazil

Programa de Pós Graduação em Biologia Celular e Molecular, Pontifícia Universidade

Católica do Rio Grande do Sul, Porto Alegre, RS, Brazil

Programa de Pós-Graduação em Biologia Celular e Molecular, Universidade Federal

do Rio Grande do Sul, Porto Alegre, RS, Brazil

Laboratório de Espectrometria de Massas, Empresa Brasileira de Pesquisa

Agropecuária-Recursos Genéticos e Biotecnologia, Estação Parque Biológico, Brasília,

DF, Brazil

Keywords: Mycobacterium tuberculosis; Pyrimidine salvage pathway; Cytidine

deaminase; Protein purification; Enzyme kinetics; Drug target.

Running title: Cytidine deaminase from Mycobacterium tuberculosis

*To whom correspondence may be addressed: Luiz A. Basso or Diógenes S. Santos

Av. Ipiranga 6681 – TecnoPUC – Prédio 92A, Porto Alegre, RS 90619-900, Brazil.

Phone/Fax: +55 51 33203629; E-mail addresses: luiz[email protected] or

[email protected].

Abbreviations used: CDA, cytidine deaminase; ESI-MS, electrospray ionization mass

spectrometry; IPTG, isopropyl-β-D-thiogalactopyranoside; MDR-TB, multidrug-

resistant TB; SDS-PAGE, sodium dodecyl sulfate polyacrylamide gel electrophoresis;

TB, tuberculosis; XDR-TB, extensively drug-resistant TB.

Abstract

Human tuberculosis (TB), caused by Mycobacterium tuberculosis,

remains a leading cause of mortality. The emergence of drug resistant strains of

M. tuberculosis has exacerbated the treatment and control of TB. There is thus

a continuous need to identify promising targets for the development of anti-TB

agents. Cytidine deaminase (CDA) is a pyrimidine salvage pathway enzyme

that recycles cytidine and 2’-deoxycytidine for uridine and 2’-deoxyuridine

synthesis, respectively. A probable CDA gene (cdd, Rv3315c) from M.

tuberculosis H37Rv was cloned, sequenced, and expressed in Escherichia coli

BL21(DE3) cells. The purification protocol of recombinant M. tuberculosis CDA

(MtCDA) yielded 35 mg of homogeneous protein from 10 g of cells. Mass

spectrometry, N-terminal amino acid sequencing, and gel filtration

chromatography confirmed the predicted molecular mass, identity, and

oligomeric state of MtCDA, which was estimated to be 52.99 kDa. These results

and multiple sequence alignment suggest that MtCDA is a homotetramer in

solution. Steady-state kinetic measurements yielded the following parameters:

and k

cat

values of, respectively, 1004 µM and 4.8 s

-1

for cytidine, and 1059

µM and 3.5 s

-1

for 2’-deoxycytidine. The pH dependence of k

cat

and k

cat

for

cytidine indicate that protonation of a single ionizable group with apparent pK

value of 4.3 abolishes activity, and protonation of a group with pK

value of 4.7

reduces binding. The demonstration that the Rv3315c locus encodes a protein

having CDA activity in M. tuberculosis is the first step to understand the role of

this gene product and should help the design of anti-TB agents and vaccines.

Introduction

Human tuberculosis (TB) is an infectious disease, caused primarily by

Mycobacterium tuberculosis; that remains a major challenge to public health

systems worldwide, specially in poor and developing nations. Over 9 million

people develop TB and 2 million die annually [1]. Based on TB skin tests, the

World Health Organization estimates that one-third of the world’s population is

currently infected with M. tuberculosis in a latent form and, therefore, at risk of

developing the active disease [2]. The emergence of multidrug-resistant (MDR,

resistant to at least isoniazid and rifampicin, the most potent anti-TB drugs) and

extensively drug-resistant (XDR, resistant to first- and second-line anti-TB

drugs) strains of M. tuberculosis have exacerbated the treatment and control of

TB. Approximately 0.5 million cases of MDR-TB emerged in 2006; in addition,

new cases of XDR-TB have been notified in 45 countries in all five continents

[3, 4]. The ability of M. tuberculosis to persist in host tissues results in the

requirement of prolonged administration of chemotherapeutic agents to achieve

in vivo bactericidal effects [5]. More effective and less toxic anti-TB drugs acting

on novel mycobacterial targets are needed to shorten the duration of current

therapy, to improve the treatment of MDR- and XDR-TB cases, and to provide

an efficient alternative to eliminate/eradicate latent M. tuberculosis infection.

Pyrimidine nucleotides are essential for DNA replication and RNA

transcription, as well as many other cellular functions, such as phospholipid

biosynthesis and regulation of enzyme activity by uridylylation. As fundamental

components of critical cellular processes, their biochemical pathways constitute

attractive targets for drug development. There are two major pathways for

pyrimidine nucleotide synthesis: the de novo and the salvage pathway. While

the de novo pathway demands higher energy levels for pyrimidine biosynthesis

from simple precursors, cells use the salvage pathway to reutilize pyrimidine

bases and nucleosides derived from preformed nucleotides [6]. In addition, the

pyrimidine salvage pathway enzymes enable organisms to acquire exogenously

supplied pyrimidine bases and nucleosides, which may not be synthesized by

certain species [7, 8]. Although M. tuberculosis pyrimidine salvage pathway

appears to be similar to that of Escherichia coli and even mammalian cells, it is

expected that M. tuberculosis will exhibit unique regulatory properties in

correlation with its pathogenicity and slow growth [9].

As pertains to rational drug development, a promising target should be

essential for survival of a pathogen and absent from its host. Alternatively, a

promising target may play an important role in adaptation of the pathogen to a

particular physiological state of the host. Since no transporters for bases,

nucleosides or nucleotides of nucleic acids could be identified in M. tuberculosis

[10], it is thus likely that M. tuberculosis has to recycle bases, nucleosides,

and/or nucleotides to survive in the hostile environment offered by the host

macrophages. In general, pyrimidine bases and nucleosides, which are the

transportable precursors of the nucleotides, are not available as exogenous

nutrients to most bacteria [7]. Accordingly, an understanding of the mode of

action and role of M. tuberculosis pyrimidine salvage pathway enzymes could

unveil new targets for the rational design of potent and selective antitubercular

agents capable of, hopefully, preventing progression and reactivation of the

disease.

Cytidine deaminase (CDA; EC 3.5.4.5), an evolutionarily conserved

enzyme of the pyrimidine salvage pathway, catalyzes the hydrolytic

deamination of cytidine and 2’-deoxycytidine to form uridine and 2’-

deoxyuridine, respectively [11]. The hydrolytic deamination of cytidine

nucleosides catalyzed by CDA has been characterized in different organisms,

including E. coli [12, 13], Bacillus subtilis [14], Saccharomyces cerevisiae [15],

human liver [16], and others. The CDA protein family tends to form multi-subunit

complexes. E. coli CDA occurs as a homodimer with two active sites formed by

contributions from each monomer [17]. On the other hand, human CDA is a

homotetramer having one active site in each 16.2 kDa subunit [18], whereas B.

subtilis CDA is a homotetramer with subunit molecular mass of 14.9 kDa [14]. In

M. tuberculosis, a putative cdd (Rv3315c) gene has been identified in the

genome of the H37Rv strain by sequence similarity [19]. However, the first step

to try to understand the role of this gene product should be demonstration that

the Rv3315c locus indeed encodes a protein having CDA activity in M.

tuberculosis.

In the present work, we report cloning, heterologous recombinant protein

expression in E. coli, purification to homogeneity, N-terminal amino acid

sequencing, electrospray ionization mass spectrometry analysis, and size

exclusion chromatography of a functional cdd-encoded M. tuberculosis CDA

(MtCDA). We also report determination of steady-state kinetic parameters and

pH-rate profiles of MtCDA. These results provide a solid foundation on which to

base gene replacement experiments aiming at understanding the role of CDA, if

any, in survival and/or latency of the bacillus, which should pave the way for the

design of new anti-TB agents and/or the development of new vaccines.

Materials and Methods

Bacterial strains, media, and growth conditions. E. coli DH10B and

BL21(DE3) (Novagen) strains were grown at 37 °C in Luria-Bertani (LB; Difco)

medium at 180 rpm containing 50 µg mL

-1

ampicillin.

PCR amplification, cloning, and DNA sequencing of the cdd coding

sequence. Based on the published genome sequence from M. tuberculosis

H37Rv [19], two oligonucleotide primers, CDD1 (5’-gc cat atg cct gat gtc gat tgg

aat atg ctg-3’) and CDD2 (5’-ga aag ctt tca ccg gcg ttc ccg ggg gag-3’),

complementary to the 5’ N-terminal and the 3’ C-terminal ends of the probable

cdd (Rv3315c) gene, were synthesized to contain, respectively, NdeI and

HindIII restriction sites (bold). These primers were used to amplify the cdd

coding sequence (402 bp) from M. tuberculosis H37Rv genomic DNA. Using

standard PCR conditions (an initial denaturation step at 98 °C for 5 min, 35

cycles of denaturation at 98 °C for 30 s, annealing at 55 °C for 55 s, and

extension at 72 °C for 2 min, and a final extension step for 10 min at 72 °C) and

Pfu DNA polymerase for high-fidelity amplification (Stratagene), the amplified

product was purified by electrophoresis on a low-melting agarose gel, digested

with NdeI and HindIII (New England Biolabs), and ligated into the pET-23a(+)

expression vector (Novagen). Nucleotide sequence of the M. tuberculosis cdd

gene was determined by automated DNA sequencing to confirm the identity,

integrity, and absence of PCR-introduced mutations in the cloned gene.

Expression of recombinant MtCDA in E. coli. The recombinant plasmid

pET-23a(+)::cdd was transformed into electrocompetent E. coli BL21(DE3) cells

and selected on LB agar plates containing 50 µg mL

-1

ampicillin [20]. A single

colony was used to inoculate 50 mL of LB medium in 250 mL flasks, and grown

as mentioned above. As cell cultures reached an OD

600

value of 0.4-0.6, the

cells were either induced with 1 mM isopropyl-β-D-thiogalactopyranoside (IPTG)

or not induced; and the cells collected at 3, 6, 9, 12, 24, and 48 h post-

induction. The same procedure was employed for E. coli BL21(DE3) cells

transformed with the pET-23a(+) vector only, which was used as an

experimental control. Cells were harvested at the indicated time points by

centrifugation at 20,800g for 5 min at 4 °C, and the supernatant discarded. Cell

pellets were suspended in 600 µL Tris-HCl 50 mM pH 7.5 (buffer A), disrupted

by sonication at 4 °C (2 pulses of 10 s each at an amplitude value of 21 %) and

cell debris was separated by centrifugation at 48,000g for 30 min at 4 °C. The

soluble extract fractions were analyzed by sodium dodecyl sulfate

polyacrylamide gel electrophoresis (SDS-PAGE) [21].

Purification of recombinant MtCDA. Single colonies were used to

inoculate 700 mL of LB medium in 2 L flasks, and grown for 6 h past an OD

600

of 0.4-0.6, without addition of IPTG, which was the optimized protocol for CDA

expression as discussed below. All subsequent steps were performed at 4 °C,

unless stated otherwise. Cells were harvested by centrifugation at 10,879g for

30 min. The resulting cell paste (10 g) was suspended in buffer A (5 mL per

gram), cells were disrupted by sonication (15 pulses of 10 s each at an

amplitude value of 60 %) and centrifuged at 23,500g for 30 min. Nucleic acid

precipitation present in the supernatant was carried out by addition of

streptomycin sulfate 1 % (final concentration), stirring the mixture 30 min, and

centrifugation at 48,000g for 30 min. The supernatant containing soluble CDA

was dialyzed against buffer A (3 x 1 L, 3 h each) using a dialysis tubing with a

3.5 kDa molecular weight cut off (MWCO) and centrifuged at 48,000g for 30

min. The supernatant was loaded on a Q Sepharose Fast Flow column (GE

Healthcare) pre-equilibrated with buffer A. The column was washed with 10

column volumes of buffer A and the adsorbed material was eluted with a linear

gradient (0-100%) of 15 column volumes of 50 mM Tris-HCl pH 7.5 containing

500 mM NaCl (buffer B). The fractions containing the target protein were pooled

and concentrated using an AMICON ultrafiltration membrane (MWCO = 30 kDa)

and loaded on a Sephacryl S-200 column (GE Healthcare) pre-equilibrated with

buffer A. The column was washed with 1.5 column volumes of buffer A at 0.25

mL min

-1

flow-rate. The fractions containing the target protein were pooled,

incubated with ammonium sulfate to a final concentration of 1 M, stirred for 30

min, and clarified by centrifugation at 23,500g for 30 min. The supernatant was

loaded on a Butyl-Sepharose High Performance column (GE Healthcare) pre-

equilibrated with 50 mM Tris-HCl pH 7.5 containing 1 M (NH

)

(buffer C).

The column was washed with 7 column volumes of buffer C and the adsorbed

material was eluted with a linear gradient (0-100%) of 20 column volumes of

buffer A. All fractions were analyzed by SDS-PAGE and the fractions containing

homogeneous CDA were pooled and stored at -80 °C. Protein concentration

was determined by the method of Bradford [22] using the Bio-Rad protein assay

kit (Bio-Rad) and bovine serum albumin as a standard.

Determination of MtCDA molecular mass. The molecular mass of native

M. tuberculosis CDA recombinant protein was determined by gel filtration

chromatography using a Superdex 200 (HR 10/30) (GE Healthcare) pre-

equilibrated with 50 mM Tris-HCl pH 7.5 containing 200 mM NaCl at a flow rate

of 0.4 mL min

-1

. The LMW and HMW Gel Filtration Calibration Kit (GE

Healthcare) was used for protein molecular mass standards in the calibration

curve, measuring the elution volumes (V

) of several standards (ferritin,

catalase, aldolase, albumin, ovalbumin, chymotrypsinogen A, and Ribonuclease

A), calculating their corresponding partition coefficients (K

), and plotting these

values versus the logarithm of their molecular masses. K

values were

determined as K

= (V

− V

)/(V

− V

), where V

and V

are the elution volume

of a sample and total bed volume of the column, respectively, and V

is the void

volume, which was determined by loading blue dextran 2000 (GE Healthcare) to

the column. Protein elution was monitored at 215, 254 and 280 nm.

Mass spectrometry analysis. Recombinat MtCDA was analyzed by

MALDI-TOF/TOF on an ABI 4700 Proteomics Analyzer (Applied Biosystems,

Framingham, MA, USA), an Ultraflex II (Bruker Daltonics, Germany) and a Q-

TOF Ultima API (Micromass, UK) as described elsewhere [23].

N-terminal amino acid sequencing. N-terminal amino acid residues of

recombinant homogeneous MtCDA were determined by automated Edman

degradation sequencing using a PPSQ 23 protein peptide sequencer

(Shimadzu Co., Japan) [23].

MtCDA activity assay and determination of steady-state kinetic

parameters. MtCDA enzyme activity assays were performed for all purification

steps following the direct spectrophotometric assay described by Cohen and

Woldfenden [13]. In short, the time-dependent decrease in absorbance at 282

nm (ε

cytidine

= 3.6 M

-1

; ε

2’-deoxycytidine

= 6.4 M

-1

) upon conversion of

cytidine or 2’-deoxycytidine to converted to uridine or deoxyuridine, respectively,

was monitored using an UV-2550 UV/Visible spectrophotometer (Shimadzu)

equipment. Determination of steady-state kinetic parameters for cytidine and 2’-

deoxycytidine were determined as a function of substrate concentrations

ranging from 50 to 1100 µM. The enzymatic assays were monitored using 0.5

cm light path quartz cuvettes, in 50 mM Tris-HCl buffer pH 7.5 at 25 °C, and

initiated with addition of 4.11 µM of homogeneous recombinant MtCDA [13].

One unit of enzyme activity (U) is defined as the amount of enzyme required to

deaminate 1 µmol of either cytidine or 2’-deoxycytidine per min.

pH Profiles. The dependence of the kinetic parameters on pH was

studied using cytidine as the variable substrate in a buffer mixture of MES-

HEPES-CHES over the following pH values: 4.0, 4.5, 5.0, 6.0, 7.5, 9.0, 10.0 and

11.0 [24]. Profiles were generated by plotting the either the logk

cat

or logk

cat

versus the pH values, and data fitted to eq (1), where y is the apparent kinetic

parameter, C is the pH-independent plateau value of y, H is the hydrogen ion

concentration, and K

is the apparent acid dissociation constant for ionizing

groups. It should be pointed out that data fitting employed the pH range of 4.0-

6.0 for logk

cat

versus pH plot and of 4-11 for logk

cat

versus the pH plot.













loglog

(1)

Results and Discussion

cdd amplification, cloning, and sequencing. PCR amplification of a

probable MtCDA coding sequence (cdd, Rv3315c) from M. tuberculosis H37Rv

genomic DNA yielded a product with the expected size (402 bp), which was

ligated into the pET-23a(+) expression vector. Nucleotide sequence analysis of

M. tuberculosis cdd coding sequence confirmed both identity and integrity of the

cloned product, showing that no mutations were introduced by the PCR

amplification steps.

M. tuberculosis CDA expression. Recombinant MtCDA was expressed in

E. coli BL21(DE3) host cells transformed with the pET-23a(+)::cdd plasmid. The

best experimental condition found for MtCDA expression in BL21(DE3) was 6

hours of growth after the cell culture reached an OD

600

value of 0.4-0.6 without

IPTG induction (data not shown). SDS-PAGE analysis showed that cell extracts

contained a recombinant protein in the soluble fraction with an apparent

molecular mass of 14 kDa, in agreement with the expected size of 14,072 Da

for MtCDA (Fig. 1).

The pET system makes use of the powerful T7 RNA polymerase, under

control of IPTG-inducible lacUV5 promoter, to transcribe the respective cloned

target genes [25]. Expression of cdd gene product showed that high levels of

protein production can be obtained in stationary phase for cells growing in the

absence of inducer as has been previously reported elsewhere [26, 27, 28]. It

has been suggested this phenomenon is due to derepression of lac operon

requiring cyclic-AMP [29].

M. tuberculosis CDA purification. Recombinant MtCDA was purified as

described under Materials and Methods; each chromatographic step was

analyzed by SDS-PAGE and assayed for enzyme activity, in the forward

direction. In the first purification step, an anion-exchange chromatography (Q

Sepharose Fast Flow column), the target protein was eluted with approximately

0.9 % of buffer B and these fractions were pooled as indicated by SDS-PAGE

analysis (Fig. 2). This step resulted in 2.4-fold protein purification (Table 1), with

removal of some contaminants with apparent subunit molecular mass values

larger than 20 kDa (Fig. 2). The second purification step, gel filtration

chromatography (Sephacryl S-200 column), resulted in 1.8-fold protein

purification, with the removal of a substantial amount of contaminants (Fig. 2).

This decrease in the purification-fold might have been affected by the

contaminants purified during this chromatographic this step, for instance

removal of MtCDA activators, or simply due to uncertainties in protein

concentration determination that are inherent to every method. The recombinant

protein was suspended in 50 mM Tris-HCl pH 7.5 containing 1 M (NH

)

(buffer C) and loaded on a hydrophobic interaction column (Butyl-Sepharose

High Performance), the third and final purification step; the target protein was

eluted with approximately 44 % of buffer C and yielded homogeneous MtCDA in

solution, with protein yield of approximately 10 % (Table 1). The 2.3-fold

purification protocol yielded approximately 35 mg (Table 1) of homogeneous M.

tuberculosis CDA from 10 g of cells.

MtCDA molecular mass determination. The subunit molecular mass of

MtCDA was determined to be 13,938.55 Da by electrospray ionization mass

spectrometry (ESI-MS), indicating the removal of the N-terminal methionine

residue (theoretical molecular mass 14,075.15 Da; predicted methionine

molecular mass = 131.20 Da) and the loss of four protons due to oxidation of

two of the three disulfides bonds. These results provide evidence that confirms

the identity and purity of the recombinant MtCDA.

The protein native molecular mass determined by gel filtration

chromatography showed a single peak with elution volume consistent with a

molecular mass of 52.99 kDa, suggesting that the recombinant MtCDA protein

is a tetramer in solution. In agreement with other studies, the comparative

alignment of CDA from different sources, such as B. subtilis, indicates that CDA

contains two conserved tyrosine residues that are not found in any dimeric CDA

sequence, which appears to be strictly correlated with a tetrameric quaternary

structure in deaminases [30].

N-terminal amino acid sequencing. The Edman degradation method

identified the first 30 N-terminal amino acid residues of recombinant MtCDA as

PDVDWNMLRGNATQAAAGAYLPYSRFAVGA. This result unequivocally

demonstrates that the homogeneous recombinant protein is MtCDA and

confirms the removal of the N-terminal methionine. Protein N-terminal

methionine excision is a common type of co-/post-translational modification

process that occurs in the cytoplasm of many organisms and in two organelles

(i.e. mitochondria and plastids) displaying protein synthesis. Methionine

aminopeptidase catalyzed cleavage of initiator methionine is usually directed by

the penultimate amino acid residues with the smallest side chain radii of

gyration (Gly, Ala, Ser, Thr, Pro, Val, and Cys) [31]. The removal of N-terminal

methionine from MtCDA is in agreement with this rule, since proline is in the

penultimate N-terminal amino acid residue.

Sequence alignment of CDAs from M. tuberculosis H37Rv, M. bovis

AF2122, M. leprae ML2174, M. marinum MMAR_1204, M avium 4296, M.

smegmatis, and B. subtilis was carried out using Clustal W [32]. The identity

between the CDA sequences was 21.58 % and almost all of the residues that

are conserved among the CDAs from the 7 organisms analyzed (Fig. 3) are

involved in interactions that are important for the substrate, zinc ion binding and

tetrameric interactions. The relationships between the conserved residues and

their functional roles have been reported for CDAs from other organisms [14,

30, 33, 34]. Here we briefly discuss the probable role of conserved residues in

M. tuberculosis CDA sequence. The residues Phe27, Asn45, Glu47, Ala57, and

Phe128 (M. tuberculosis numbering) mediate substrate-binding and were

conserved in all sequences. Residues Cys56, Glu58, Cys89, and Cys92 are

reported as probable zinc ligands for B. subtillis and E. coli CDAs, and were

absolutely conserved in all sequences analyzed here [17, 33, 34]. The zinc

ligand is coordinated to three cysteines in tetrameric B. subtillis CDA [30], which

is in agreement with the three conserved cysteine residues (Cys56, Cys89, and

Cys92) and the tetrameric oligomeric state of MtCDA reported here. In M.

tuberculosis Ser25, Arg93, Gln94, Glu98, and Leu124 are related to tetrameric

interactions. The tetrameric CDAs contain two highly conserved tyrosine

residues not found in any of the dimeric CDA sequences [30], which correspond

to the two highly conserved tyrosine residues (Tyr24 and Tyr51) identified in

MtCDA sequence (Fig. 3) and is in agreement with the experimental results

here reported.

MtCDA kinetics. The activity of MtCDA was linearly dependent on sample

concentration added to the reaction mixture for both cytidine and 2’-

deoxycytidine (Fig. 4), demonstrating that true initial velocities are being

measured. The steady-state kinetic parameters determined for MtCDA are

summarized in Table 2. Data were fitted to a hyperbolic equation, suggesting

that MtCDA reaction obeys Michaelis–Menten kinetics (Fig. 5). The K

and k

cat

values were, respectively, 1004 ± 53 µM and 4.8 ± 0.1 s

-1

for cytidine and 1059

± 64 µM and 3.5 ± 0.1 s

-1

for 2’-deoxycytidine. The MtCDA K

values are larger

than E. coli CDA (220 µM for cytidine and 58 µM for 2’-deoxycytidine).

Furthermore, the k

cat

value for M. tuberculosis CDA was lower than the ones

reported for E. coli and human liver CDAs (136.6 s

-1

and 65 s

-1

, respectively)

[12]. The specificity constant values (k

cat

) for both substrates are quite

similar (Table 2: 4.8 x 10

-1

for cytidine and 3.3 x 10

-1

for 2’-

deoxycytidine), which indicates that MtCDA has no preference for any of the

two substrates (cytidine or 2’-deoxycytidine) free in solution. The E. coli CDA

has been shown to be more specific for 2’-deoxycytidine than cytidine [12, 35].

Our results, however, demonstrate that MtCDA has similar specificity for both

substrates. Interestingly, even though further studies are required to show

whether or not MtCDA is a metalloenzyme or metal-ion activated, here we

demonstrate that recombinant MtCDA catalyzes deamination of cytidine and 2’-

deoxycytidine in the absence of any metal.

To assess the role of acid/base chemistry in the MtCDA enzymatic

reaction, the pH dependence of k

cat

and k

cat

for cytidine was studied. The

pH-rate profiles of the kinetic parameters using cytidine as substrate are shown

in Fig. 6. It should be pointed out that data fitting employed the pH range of 4.0-

6.0 for logk

cat

versus pH plot and of 4-11 for logk

cat

versus pH plot. The pH

rate profile for k

cat

was quite complex. It showed a decrease at low pHs with a

slope of 1 (Fig. 6A), demonstrating that protonation of a group with apparent

value of 4.3 ± 1.0 abolishes MtCDA activity for cytidine as substrate.

Moreover, pH rate profile for k

cat

indicates that a group with apparent pK

value

of 8-9 increases even further the catalytic rate when deprotonated. Even though

pH dependence profiles exhibiting three pK

values have been described [24],

measurements of enzyme activity at pH values larger than 11 would be required

for MtCDA. However, most enzymes and proteins undergo denaturative

changes in conformation when exposed to pH values above 10-12 [36]. At any

rate, it is preliminary to invoke more complex models at this point and further

experimental results should be provided. The k

cat

profile showed a decrease

at low pH values with a slope of 1 (Fig. 6B), suggesting that protonation of a

single ionizable group, exhibiting an apparent pK

value of 4.7 ± 0.7, reduces

cytidine binding. The pK

values of 4.3 for k

cat

and of 4.7 for k

cat

/ K

lie in the

normal pK range for the

-carboxyl of aspartate and

-carboxyl of glutamate

amino acid acid residues. A glutamic acid residue has been shown to be

conserved in dimeric and tetrameric CDAs from different organisms and was

correlated with substrate binding [30, 33]. The pH-rate profiles of E. coli and B.

subtillis indicated a decrease at low pHs, with pK

values of 4.7 and 5.4,

respectively, which also display a single protonated group [30]. It is thus

tempting to suggest that the conserved Glu47 residue of MtCDA (Fig. 3) plays

an important role in substrate binding. Site-directed mutagenesis, equilibrium

binding, and measurements of steady-state kinetic parameters of mutant protein

will have to be carried out to ascertain whether Glu47 plays any role in

substrate binding and/or catalysis.

Enzyme kinetics and structural studies provide a framework on which to

base the target-based rational design of new agents with antitubercular activity.

However, the availability of sufficient amounts of proteins of M. tuberculosis still

remains an essential and laborious step. Unfortunately, even when a genome

can be sequenced, only up to 20 % of the protein targets can produce soluble

proteins under very basic experimental conditions [37]. Thus, expression of

proteins in soluble form has been identified as an important bottleneck in efforts

to determine biological activity and crystal structure of M. tuberculosis proteins

[38]. The results presented here will provide homogeneous MtCDA in quantities

necessary for studies on the enzyme mechanism of action by pre-steady-state

kinetics, its metal requirement by atomic absorption spectroscopy, three-

dimensional structure determination by X-ray diffraction. Incidentally, MtCDA

has been crystallized, X-ray diffraction patterns collected and structural

refinement underway, which should be reported shortly elsewhere. We believe

that the results reported here are pivotal to further efforts towards

understanding the role, if any, of pyrimidine salvage pathway in M. tuberculosis

survival and/or persistence by gene replacement, as well as MtCDA functional

and structural studies on which to base the rational design of antitubercular

agents.

Acknowledgments

This work was supported by National Institute of Science and Technology

on Tuberculosis (Decit/SCTIE/MS-MCT-CNPq-FNDCT-CAPES) and Millennium

Initiative Program (CNPq), Brazil, to DSS and LAB. DSS and LAB also

acknowledge grants awarded by FINEP. DSS (304051/1975-06) and LAB

(520182/99-5) are research career awardees from the National Council for

Scientific and Technological Development of Brazil (CNPq). ZASQ

acknowledges a scholarship awarded by CNPq. The authors are grateful to

Lucas S. Toniolo and Sarah L. Selbach for technical assistance.

References

1. C. Dye, S. Scheele, P. Dolin, V. Pathania, M.C. Raviglione, Global

burden of tuberculosis: Estimated incidence, prevalence, and mortality by

country. WHO Global Surveillance and Monitoring Project, J Am Med Ass

282 (1999) 677–686.

2. WHO/Stop TB Partnership. The Global Stop TB 2006-2015.

WHO/HTM/STB/2006.35, Wold Health Organization (http://www.who.imt).

3. CDC. Emergence of Mycobacterium tuberculosis with Extensive

Resistance to Second-Line Drugs Worldwide, 2000-2004, MMWR 55 (2006)

301-305.

4. A. Jain, R. Mondal, Extensively drug-resistant tuberculosis: current

challenges and threats, FEMS Immunol Med Microbiol 53 (2008) 145-50.

5. L.A. Basso, L.H.P. Silva LH, A.G. Fett-Neto, W.F. Azevedo Jr, I.S.

Moreira, M.S. Palma, J.B. Calixto, S. Astolfi Filho, R.R. Santos, M.B.

Soares, D.S. Santos, The use of biodiversity as source of new chemical

entities against defined molecular targets for treatment of malaria,

tuberculosis, and T-cell mediated diseases-a review, Mem. Inst. Oswaldo

Cruz 100 (2005) 475-506.

6. G. E. Shambaugh, Pyrimidine biosyntesis, Am. J Clin Nutr 32 (1979)

1290-1297

7. P. R. Wheeler, Biosynthesis and scavenging of pyrimidines by

pathogenic mycobacteria, J Gen Microbiol 136 (1990) 189-201.

8. J. E. Hyde, Targeting purine and pyrimidine metabolism in human

apicomplexan parasites, Curr. Drug Targets, 8 (2007) 31-47.

9. S.T. Cole, K.D. Eisenach, D.N. McMurray, W.R. Jacobs, Tuberculosis

and the Tubercle Bacillus, ASM Press, Washington, D.C., 2005.

10. M. Braibant, P. Gilot, J. Content, The ATP binding cassette (ABC)

transport systems of Mycobacterium tuberculosis, FEMS Microbiol. Rev. 24

(2000) 449-467.

11. C.W. Carter, The nucleoside deaminases for cytidine and adenosine:

Structure, transition state stabilization, mechanism, and evolution, Biochimie

77 (1995) 92-98.

12. G.W. Ashley, P.A. Bartlett, Purification and Properties of Cytidine

Deaminase from Escherichia coli, J Biol Chem 259 (1984) 13615-13620.

13. R.M. Cohen, R, Wolfenden, Cytidine deaminase Escherichia coli, J Biol

Chem 246 (1971) 7561-7565.

14. B.H. Song, J. Neuhard, Chromosomal location, cloning and nucleotide

sequence of the Bacillus subtilis cdd gene encoding cytidine/deoxycytidine

deaminase, Mol Gen Genet 216 (1989) 462-468.

15. P.L. Itapa, G. Cercignani, E. Balestreri, Partial purification and properties

of Cytidine deaminase from Baker’s yeast, Biochemistry 9 (1970) 3390-

3395.

16. D.F. Wentworth and R. Wolfenden, Cytidine deaminases (from

Escherichia coli and human liver), Biochemistry 14 (1983) 5099-5105.

17. L. Betts, S. Xiang, S.A. Short, R. Wolfenden, C.W. Carter, Cytidine

deaminase. The 2.3 A crystal structure of an enzyme: transition-state analog

complex, J Mol Biol 235 (1994) 635-656.

18. A. Vita, T. Cacciamani, P. Natalini, S. Puggieri, G. Magn, Cytidine

deaminase from human spleen, Exp Med Biol 253 (1989) 71-77.

19. S.T. Cole, R. Brosch, J. Parkhill, T. Garnier, C. Churcher, D. Harris, S.V.

Gordon, K. Eiglmeier, S. Gas, C.E. Barry III, F. Tekaia, K. Badcock, D.

Basham, D. Brown, T. Chillingworth, R. Connor, R. Davies, K. Devlin, T.

Feltwell, S. Gentles, N. Hamlin, S. Holroyd, T. Hornsby, K. Jagels, B.G.

Barrell, Deciphering the biology of Mycobacterium tuberculosis from the

complete genome sequence, Nature 393 (1998) 537–544.

20. J. Sambrook, D.W. Russell, Molecular Cloning A laboratory Manual, Cold

Spring Harbor Laboratory Press, New York, 2001.

21. U.K. Laemmli, Cleavage of structural proteins during the assembly of the

head of bacteriophage T4, Nature 227 (1970) 680-685.

22. M.M. Bradford, A rapid and sensitive method for the quantitation of

microgram quantities of protein utilizing the principle of protein-dye binding,

Anal Biochem 72 (1976) 248-254.

23. G.D. Brand, F.C. Krause, L.P. Silva, J.R. Leite, J.A. Melo, M.V. Prates,

J.B. Pesquero, E.L. Santos, C.R. Nakaie, C.M. Costa-Neto, C.Jr. Bloch,

Bradykinin related peptides from Phyllomedusa hypochondrialis, Peptides

27 (2006) 2137-2146.

24. P.F. Cook, W.W. Cleland, pH dependence of kinetic parameters and

isotope effects, in Enzyme Kinetics and Mechanisms, Garland Science,

London and New York, 2007, pp. 325-366.

25. K.C. Kelley, K.J. Huestis, D.A. Austen, C.T. Sanderson, M.A. Donoghue,

S.K. Stickel, E.S. Kawasaki, M.S. Osburne, Regulation of CD4-183 gene

expression from phage-T7-based vectors in Escherichia coli, Gene 156

(1995) 33–36.

26. J.S. Oliveira, C.A. Pinto, L.A. Basso, D.S. Santos, Cloning and

overexpression in soluble form of functional shikimate kinase and 5-

enolpyruvylshikimate 3-phosphate synthase enzymes from Mycobacterium

tuberculosis, Protein Expr. Purif. 22 (2001) 430–435.

27. R.G. Silva, L.P. Carvalho, J.S. Oliveira, C.A. Pinto, M.A. Mendes, M.S.

Palma, L.A. Basso, D.S. Santos, Cloning, overespression, and purification of

functional human purine nucleoside phosphorylase, Protein Exp. Purif. 27

(2003) 158–164.

28. C. Rizzi, J. Frazzon, F. Ely, P.G. Weber, I.O. Fonseca, M. Gallas, J.S.

Oliveira, M.A. Mendes, B.M. Souza, M.S. Palma, D.S. Santos, L.A. Basso,

DAHP synthase from Mycobacterium tuberculosis H37Rv: cloning,

expression, and purification of functional enzyme, Protein Expr. Purif.40

(2005) 23-30.

29. T.H. Grossman, E.S. Kawasaki, S.R. Punreddy, M.S. Osburne.

Spontaneous cAMP-dependent derepression of gene expression in

stationary phase plays a role in recombinant expression instability, Gene

209 (1998) 95–103.

30. D.C. Carlow, C.W. Carter, N. Mejhede, R. Wolfenden, Cytidine

Deaminases from B. subtilis and E. coli: Compensating Effects of Changing

Zinc Coordination and Quaternary Structure, Biochemistry 38 (1999) 12258-

12265.

31. P.H. Hirel, M.J. Schmitter, P. Dessen, G. Fayat, S. Blanquet, Extent of N-

terminal methionine excision from Escherichia coli proteins is governed by

the side-chain length of the penultimate amino acid, Proc Natl Acad Sci 86

(1989) 8247 –8251.

32. J.D. Thompson, D.G. Higgins, T.J. Gibson, CLUSTAL W: improving the

sensitivity of progressive multiple sequence alignment through sequence

weighting, positions-specific gap penalties and weight matrix choice, Nucleic

Acids Research 22 (1994) 4673-4680.

33. E. Johansson, N. Mejlhede, S. Larsen, Crystal Structure of the Cytidine

Deaminase from Bacillus subtilis at 2.0 Å Resolution, Biochemistry 41

(2002) 2563-2570.

34. E. Johansson, J. Neuhard, M. Willemoe, S. Larsen, Structural, Kinetic,

and Mutational Studies of the Zinc Ion Environment in Tetrameric Cytidine

Deaminase, Biochemistry 43 (2004) 6020-6029.

35. R.B. Trimble, F. Maley, Metabolism of 4-N-Hydroxy-Cytidine in

Escherichia coli, J. Bacteriol. 108 (1971) 145-153.

36. S. Englard, S. Seifter, Precipitation techniques, Methods Enzymol. 182

(1990) 285-300.

37. S.A. Lesley, P. Kuhn, A. Godzik, A.M. Deacon, I. Mathews, A. Kreusch,

G. Spraggon, H. E. Klock, D. McMullan, T. Shin, J. Vincent, A. Robb, L.S.

Brinen, M.D. Miller, T.M. McPhillips, M.A. Miller, D. Scheibe, J.M. Canaves,

C. Guda, L. Jaroszewski, T.L. Selby, M.A. Elsliger, J. Wooley, S.S. Taylor,

K.O. Hodgson, I.A. Wilson, P.G. Schultz, R.C. Stevens RC, Structural

genomics of the Thermotoga maritima proteome implemented in a high-

throughput structure determination pipeline, Proc. Natl. Acad. Aci. USA 99

(2002) 11664-11669.

38. R. Vicentelli, C. Bignon, A. Gruez, S. Canaan, G. Sulzenbacher, M.

Tegoni, V. Campanacci, C. Cambillau, Medium-scale structural genomics:

strategies for protein expression and crystallization, Acc. Chem. Res. 36

(2003) 197-225.

Figures and legends

Fig. 1. SDS-PAGE (15 %) analysis of total soluble protein as a function of

growth time. Lane 1, MW Bench marker (Invitrogen); Lane 2, 4, 6, and 8, E. coli

BL21(DE3) [pET-23a(+)::cdd]; lanes 3, 5, 7, and 9, E. coli BL21(DE3) [pET-

23a(+)(control)]. The times of cell growth were 3h (lanes 2 and 3), 6h (lanes 4

and 5), 9h (lanes 6 and 7), and 12h (lanes 8 and 9).

Fig. 2. SDS-PAGE (15 %) analysis of pooled fractions of the chromatographic

steps of MtCDA protein purification protocol. Lane 1, MW Bench marker

(Invitrogen); lane 2, crude extract (190.5 µg); lane 3, QSepharose Fast Flow

(207.4 µg); lane 4, Sephacryl S-200 (17.5 µg); lane 5, Butyl HP (11.6 µg). The

values given between parentheses are for the amount of total protein loaded on

each lane

Fig. 3. Multiple sequence alignment of M. tuberculosis CDA (CDA_Mtu) with

homotetrameric B. subtilis CDA (CDA_Bsu), whose crystal structure was

determined, and other potential mycobacterial CDAs: M. bovis (Mbo), M.

marinum (Mma), M. avium (Mav), M. smegmatis (Msm), and M. leprae (Mle)

using the program CLUSTALW [Thompson et al. 1994]. Identical conserved

residues are shown in white on a black background and are also indicated by

asterisks below the alignment. Strongly similar and weakly similar residues are

identified by columns and periods, respectively. Strongly similar residues are

also shaded in gray. Triangles and circles above the alignment indicate,

respectively, active-site residues involved in the presumptive ribose binding

loop and zinc coordination.

Fig. 4. Linear dependence of MtCDA activity on protein volume. Reactions were

started by addition of varying volumes of recombinant protein with 2’-

deoxycytidine (Fig. 3A) and cytidine (Fig. 3B) at a constant concentration value

of 333.6

Fig. 5. Determination of steady-state kinetic parameters. Substrate saturation

curves for (A) cytidine, and (B) 2’-deoxycytidine as the variable substrate.

Fig. 6. Dependence of kinetic parameters on pH for MtCDA-catalyzed

deamination of cytidine. (A) pH dependence of log k

cat

on pH, (B) pH

dependence of log k

cat

. Data fitting as described in Material and Methods.

log k

cat

-1

)

0.0

0.2

0.4

0.6

0.8

1.0

1.2

4 6 8 10 12

log k

cat

-1

)

2.8

3.0

3.2

3.4

3.6

3.8

Table 1.

MtCDA protein purification protocol starting from 10 g of cells obtained from

2.8 L of cell culture.

Purification step

Total protein

(mg)

Total enzyme

activity (U)

Specific activity

(U mg

-1

)

Substrate

Purification

fold

Yield (%)

1923.35 2.35 Cytidine 1 100

Crude extract 819.15

1376.36 1.68 2’-deoxycitidine 1 100

1151.95 5.55 Cytidine 2.4 60

Qsepharose FF 207.4

799.16 3.85 2’-deoxycitidine 2.3 58

363.76 4.32 Cytidine 1.8 19

Sephacryl S-200 84.14

259.49 3.08 2’-deoxycitidine 1.8 19

190.17 5.44 Cytidine 2.3 10

Butyl HP 34.98

131.13 3.75 2’-deoxycitidine 2.2 10

Table 2

. Apparent kinetic parameters for MtCDA

Substrates V

max

(U mg

-1

) K

(µM) k

cat

-1

) k

cat

-1

)

Cytidine 21 ± 1 1004 ± 53 4.8 ± 0.1

4.8 (± 0.3) x 10

2’-deoxycytidine 15 ± 1 1059 ± 64 3.5 ± 0.1

3.3 (± 0.2) x 10

All constants were measured in 50mM Tris-HCl pH 7.5 at 25 °C.

4.CONSIDERAÇÕES FINAIS

O ressurgimento de diferentes cepas de M. tuberculosis, o agente da

tuberculose, resistentes a pelo menos três drogas de segunda geração (XDR-

TB) reflete a evidente necessidade de gerar novas formas de combater a

doença para melhorar as condições do tratamento utilizado atualmente, o qual,

segundo dados da Organização Mundial da Saúde, é responsável pela morte

de uma pessoa a cada 16 segundos [22]. Levando-se em conta a importância

do estado de latência à sobrevivência do bacilo, quando diferentes genes e

rotas metabólicas são diferencialmente expressos, é necessário o

desenvolvimento de trabalhos que caracterizem com maior profundidade esta

fase da infecção por M. tuberculosis [18]. Dentre estas rotas, a possível

participação da via de salvamento de pirimidinas na viabilidade da bactéria

torna as enzimas desta via importantes alvos para o desenvolvimento de

futuros fármacos e tratamentos capazes de evitar a progressão e a reativação

da infecção.

Os programas globais de descobrimento de novas drogas

antituberculose têm prestado particular interesse na identificação de análogos

de pirimidinas com atividade seletiva contra M. tuberculosis, justificando nosso

interesse na enzima citidina deaminase do metabolismo de pirimidinas.

A amplificação e clonagem do gene cdd foi confirmada pelo

sequenciamento concluindo que o produto deste corresponde à proteína CDA

reportada para M. tuberculosis. A CDA obteve uma melhor expressão (figura 1

do artigo) durante 24 h, obtendo um pico maior às 6 h, após observamos a uma

diminuição na expressão.

A proteína pura foi obtida através de três passos cromatográficos (troca

aniônica, gel filtração e interação hidrofóbica). Diferentes colunas

cromatográficas foram testadas a fim de determinar um protocolo eficiente de

purificação. Os testes realizados para definição do protocolo encontram-se no

Anexo 2. A proteína pura apresentou atividade em todas as etapas de

purificação, mostrando uma diminuição apenas no passo de exclusão por

tamanho (gel filtração); os contaminantes encontrados podem ter ocasionado

esta diminuição na atividade devido a uma interferência na ligação enzima-

substrato.

Durante a realização dos ensaios cinéticos constatou-se a necessidade da

utilização de uma cubeta com o caminho óptico de 0.5cm, devido às altas

concentrações de substrato necessárias para alcançar a saturação desejada.

Desta forma, foi possível determinar as constantes aparentes para cada

substrato e o perfil de pH.

Por fim, experimentos de cristalização foram realizados e cristais da proteína

homogênea foram obtidos segundo o protocolo descrito no anexo 4. Estes

experimentos foram repetidos a fim de estabelecer um protocolo e estes

resultados servirão para posteriores estudos estruturais. Ensaios de

associação entre a MtCDA e alguns metais serão realizados a fim de

determinar um mecanismo de ação para a enzima. Estudos comparativos entre

a MtCDA e outras CDAs (proteínas homologas de outros organismos) também

serão realizados a fim de demonstrar uma similaridade e complementar os

resultados previamente obtidos.

Este trabalho amplia o conhecimento da citidina deaminase com o

objetivo de, futuramente, identificar inibidores naturais e/ou sintéticos que

permitam o posterior desenvolvimento de drogas para o tratamento da infecção

latente causada por M. tuberculosis, além de fornecer indícios que revelem a

eventual importância desta proteína ao metabolismo do bacilo da TB.

ANEXO 1. DESENVOLVIMENTO DA TUBERCULOSE

Adaptado de Anderson P. TRENDS in Microbiology.2006,15,7-13.

Anos depois da infecção

Elimi

nação?

Latência

Infecção latente

Doença aguda (5%)

Reativação da

infecção (5-10%)

Infecção aguda

Expressão de antígenos

secretados no estágio inicial da

infecção pela replicação da

bactéria

Infecção latente

Expressão de antígenos no

estágio tardio induzido durante a

dormência

ANEXO 2. TESTES DE PURIFICAÇÃO DA CDA DE M. tuberculosis

Os testes de purificação da CDA recombinante foram realizados

utilizando cromatografia líquida de alta eficiência (HPLC) através do

equipamento ÄKTA (GE Healthcare). As células foram preparadas a partir de

uma colônia de BL21(DE3) contendo o plasmídeo recombinante (previamente

selecionada em meio sólido com os antibióticos necessários) que foi inoculada

em 50 mL de LB líquido e cultivada a 37°C, 180 rpm por 16-18h. Do

crescimento obtido, 1 mL foi inoculado em 4 frascos de 2 L contendo 700 mL

de LB líquido com antibiótico. Quando o cultivo atingiu a OD

600

entre 0.4-0.6 foi

incubado por mais 6 horas. As células foram centrifugadas a 10,879 g por 30

min e armazenadas a -20°C. Este protocolo rendeu aproximadamente 10 g de

células.

As células foram ressuspensas na proporção de 5 mL de tampão Tris-HCl 50

mM pH 7.5 (tampão A) para cada grama de células. A fração solúvel das

células foi sonicada (15 pulsos 10s 60% de amplitude) e centrifugada a 23,500

por 30 min. O sobrenadante foi tratado com sulfato de estreptomicina 1% para

clivagem do DNA presente na amostra, centrifugada e dialisada contra o

tampão A.

Para estabelecer o protocolo final de purificação foram utilizadas diferentes

mini-colunas cromatográficas, tais como de troca catiônica (HiTrap SP FF,

HiTrap SP XL, HiTrap CM FF), de exclusão por tamanho (Sephacryl S-200), de

interação hidrofóbica (HiTrap Phenyl FF high sub, Butyl Sepharose HP, Octyl

FF), de troca aniônica (Hi Trap QFF e Hi Trap DEAE FF).

A proteína de interesse não interagiu com as colunas HiTrap de troca catiônica.

Como primeira coluna foi escolhida a coluna de troca aniônica Hi Trap QFF,

que interagiu bem com a CDA eliminando alguns dos contaminastes. Como

segunda coluna, sempre foi utilizada a Sephacryl S-200 sendo útil não só para

retirar algumas proteínas contaminantes da amostra, como também para trocar

o tampão peermitindo a utilização de uma terceira coluna. E finalmente, nas

interações hidrofóbicas houve interação da proteína alvo com a resina, sendo a

mesma foi observada no gradiente. O melhor resutado foi obtido com a Butyl

sepharose HP, utilizada como terceira coluna.

Contudo, apenas a coluna de troca catiônica HiTrap SP FF (Figura 1) e a

de exclusão por tamanho Sephacryl S-100 (Figura 2) mostraram eficiência na

eliminação dos contaminantes durante a eluição da proteína de interesse. O

protocolo de purificação da proteína está descrito no manuscrito.

ANEXO 3. CRISTALIZAÇÃO DA CDA DE M. tuberculosis

Os cristais da proteína foram obtidos pelo método de difusão de vapor em gota

pendente utilizando Hampton Crystal Screen and Crystal Screen 2 kits

(Hampton Research).

CDA foi dializada contra 20 mM Tris-HCl buffer, pH 7.5 e concentrada até 12

mg/mL. A proteína recombinante foi cristalizada em gotas que contém 2 µL de

proteina e 2 µL da solução de cristalização. Dos kits utilizados, o primeiro

(Crystal screen) formou cristais em três condições diferentes às 24h do

crescimento. Escolhemos a condição que apresentava cristais mais definidos

(Hepes 0.1 M, pH 7.5 e cloreto de sódio 4.3 M ) para posteriores estudos.

Figura 5. Cristais obtidos a partir da proteína homogenea Citidina deaminase

ANEXO 4. CONFIRMAÇÃO DO ARTIGO SUBMETIDO

From: PEP (ELS) [mailto:pep@elsevier.com]

Sent: Mon 2/23/2009 2:10 PM

To: Luiz Augusto Basso

Subject: Protein Expression and Purification: Submission Confirmation

Title: The Rv3315c locus from Mycobacterium tuberculosis H37Rv codes for a

functional cytidine deaminase that hydrolyses cytidine and 2'-deoxycytidine

Corresponding Author: Dr. Luiz Augusto Basso

Authors: Zilpa A Sanchez-Quitian, MSc; Cristopher Z Schneider, PhD; Rodrigo G

Ducati, PhD; Carlos Bloch Jr, PhD; Diogenes S Santos, PhD;

Dear Dr. Basso,

This is to confirm that the above-mentioned manuscript has been received for

consideration in Protein Expression and Purification.

You will be able to check on the progress of your manuscript by logging on to the

Elsevier Editorial System for Protein Expression and Purification as an author:

http://ees.elsevier.com/prep/

Your username is: LBASSO

If you can't remember your password, please click the "Send Password" link on the

Your paper will be given a manuscript number shortly and you will soon receive an e-

mail with this number for your reference.

Thank you for submitting your manuscript to Protein Expression and Purification.

Should you have any questions, please feel free to contact our office.

Kind regards,

Susan Ikeda

Protein Expression and Purification

Journal Manager

Elsevier

525 B Street, Suite 1900

San Diego, CA 92101-4495

USA

Phone: 619 699 6793

Fax: 619 699 6211

E-mail: [email protected]

REFERÊNCIAS BIBLIOGRÁFICAS

1. Andersen P. Vaccine strategies against latent tuberculosis infection.

Trends Microbiol. 2006 (15):7-13.

2. Ber J,Timoczko J, Stryer L. Biochemistry. Chapter Nucleotide

biosynthesis. Fifth edition, Ed. Guanabara Kogan 2002.

3. Betts L, Xiang S, Short SA, Wolfenden R, Carter CW. Cytidine

deaminase. The 2.3 A crystal structure of an enzyme: transition-state

analog complex, J Mol Biol. 1994 (235):635-656.

4. Carlow DC, Carter CW, Mejhede N, Wolfenden R. Cytidine deaminases

from B. subtilis and E. coli: Compensating Effects of changing zinc

coordination and quaternary structure, Biochemistry. 1999 (38):12258-

12265.

5. Chung SJ, Fomme C, Verdine G, Structure of human Cytidine

Deaminase bound to a potent inhibitor, J. Med. Chem 2005 (48): 658–

660

6. Cohen RM, Wolfenden R. Cytidine deaminase from Escherichia coli. J

Biol Chem. 1971 (246):7561-7565.

7. Corbett EL, Watt CJ, Walker N, Maher D, Williams BG, Raviglione MC,

Dye C. The growing burden of tuberculosis: global trends and

interactions with the HIV epidemic. Arch Intern Med. 2003 (163):1009–

21.

8. Ducati R, Ruffino-Netto A, Basso LA, Santos SD. The resumption of

consumption- A review on tuberculosis. Mem Inst Oswaldo Cruz. 2006

(101):697-714.

9. Jackson M, Berthet FX, Otal I, Rauzier J, Martin C, Gicquel B, Guilhot C.

The Mycobacterium tuberculosis purine biosynthetic pathway: isolation

and characterization of the purC and purL genes. Mycrobiol.1996

(142):2439-47.

10. Johansson E, Mejlhede N, Larsen S. Crystal Structure of the Cytidine

Deaminase from Bacillus subtilis at 2.0 Å Resolution, Biochemistry. 2002

(41):2563-2570.

11. Matteelli A, Migliori GB, Cirillo D, Centis R, Girard E, Raviglion M.

Multidrug-resistant and extensively drug-resistant Mycobacterium

tuberculosis: epidemiology and control. Expert Rev Ant Infect Ther. 2007

(5):857-71.

12. Leyten EM, Lin MY, Franken KL. Friggen A.H., Prins C., van Meijgaarden

K.E., Voskuil M.I., Weldingh K., Andersen P., Schoolnik G.K., Arend

S.M., Ottenhoff T.H. and Klein M.R. Human T-cell responses to 25 novel

antigens encoded by genes of the dormancy regulon of Mycobacterium

tuberculosis. Microbes Infect. 2006 (8):2052-60.

13. Johansson E, Neuhard J, Willemoe M, Larsen S. Structural, Kinetic, and

Mutational studies of the zinc ion environment in tetrameric Cytidine

Deaminase, Biochemistry. 2004: (43) 6020-6029.

14. Navatatnam N, Sarwar R. An overwiew of Cytidine deaminase, Int J

Hematology 2006 (83):192-200.

15. Neidhardt F. Escherichia coli and Salmonella, Celular and Molecular

Biology. Washington: ASM PRESS; 2005

16. O`Donovan, GA, Neuhard J. Pyrimidine metabolism in microorganisms.

Bact Rev. 1970 (34):278-343.

17. Pablos-Mendez A, Gowda DK, Frieden TR. Controlling multidrug-

resistant tuberculosis and access to expensive drugs: a rational

framework. Bull. World Health Organ. 2002 (80):489-95.

18. Pastel S, Parsyan A, Gunn J, Barry M, Reed C, Sharnprapai S,

Horsburgh C. Risk of progression to active tuberculosis among foreign-

born persons with latent tuberculosis. Chest J. 2007 (131):1811-1816.

19. Pasqualoto KF, Ferreira EI. An approach for the rational desing of new

antituberculose agents. Curr Drug Targets. 2001 (4):27-37.

20. Pierard A, Glansdorff N, Yashphe J, Mutations affecting uridine

monophosphate pyrophosphorylase or the argB gene in Escherichia coli.

Effects on carbamoyl phosphate and pyrimidine biosynthesis and on

uracil uptake. Mol Gen Genet. 1972 (118):235-245.

21. Somasekaram A, Jurmuz A, How A, Scott J, Intracellular Localization of

Human Cytidine Deaminase, J Biol Chem 1999 (274):28405-28412.

22. Tuberculosis Antimicrobial Acquisition and Coordinating Facility

(TAACF). Global discovery program for novel anti-tuberculosis drugs.

(http://www.taacf.org/). Acesso em: 4 set. 2008.

23. Ulmer JE, Boum Y, Thouvenel CD, Myllykalio H, Sibley H, Functional

analysis of the Mycobacterium tuberculosis FAD-dependent Thymidylate

synthase, ThyX, reveals new amino acid residues contributing to an

extended ThyX Motif. J Bacteriol. 2008 (190):2056–2064.

24. Voet D, Voet J. Bioquímica. Porto Alegre: Artes médicas; Ed. John Wiley

& Sons

2006

25. WHO (2006) Global Tuberculosis Control: Surveillance, planning,

financing, WHO/HTM/TB/2006.362, World Health Organization, Geneva

(http://www.who.int). Acesso em: 20 jul. 2008.

26. WHO/Stop TB Partnership. The Global Stop TB 2006-2015.

WHO/HTM/STB/2006.35, Wold Health Organization

(http://www.who.imt).

27. Wise J. Southern Africa is moving swiftly to combat the threat of XDR-

TB. Bull World Health Organ. 2006 (84):924-25.

28.

Wentworth DF, Wolfenden R. Cytidine deaminase (from Escherichia.coli

and human liver). Met Enz. 1978 (51):401-407.

Livros Grátis
( http://www.livrosgratis.com.br )
 
Milhares de Livros para Download:
 
Baixar livros de Administração
Baixar livros de Agronomia
Baixar livros de Arquitetura
Baixar livros de Artes
Baixar livros de Astronomia
Baixar livros de Biologia Geral
Baixar livros de Ciência da Computação
Baixar livros de Ciência da Informação
Baixar livros de Ciência Política
Baixar livros de Ciências da Saúde
Baixar livros de Comunicação
Baixar livros do Conselho Nacional de Educação - CNE
Baixar livros de Defesa civil
Baixar livros de Direito
Baixar livros de Direitos humanos
Baixar livros de Economia
Baixar livros de Economia Doméstica
Baixar livros de Educação
Baixar livros de Educação - Trânsito
Baixar livros de Educação Física
Baixar livros de Engenharia Aeroespacial
Baixar livros de Farmácia
Baixar livros de Filosofia
Baixar livros de Física
Baixar livros de Geociências
Baixar livros de Geografia
Baixar livros de História
Baixar livros de Línguas

Baixar livros de Literatura
Baixar livros de Literatura de Cordel
Baixar livros de Literatura Infantil
Baixar livros de Matemática
Baixar livros de Medicina
Baixar livros de Medicina Veterinária
Baixar livros de Meio Ambiente
Baixar livros de Meteorologia
Baixar Monografias e TCC
Baixar livros Multidisciplinar
Baixar livros de Música
Baixar livros de Psicologia
Baixar livros de Química
Baixar livros de Saúde Coletiva
Baixar livros de Serviço Social
Baixar livros de Sociologia
Baixar livros de Teologia
Baixar livros de Trabalho
Baixar livros de Turismo
 
 